Protein Info for RALBFv3_RS02885 in Ralstonia solanacearum IBSBF1503

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 101 (96 residues), 49 bits, E=1.4e-16
• PF02770: Acyl-CoA_dh_M
  • amino acids 118 to 212 (95 residues), 53.7 bits, E=3.8e-18
• PF00441: Acyl-CoA_dh_1
  • amino acids 234 to 356 (123 residues), 85.8 bits, E=7.1e-28
• PF08028: Acyl-CoA_dh_2
  • amino acids 240 to 344 (105 residues), 32.3 bits, E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_11344)

MetaCyc: 44% identical to pimeloyl-CoA dehydrogenase small subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Putative pimeloyl-CoA dehydrogenase (Small subunit), PimD-like (EC 1.3.99.-)" (EC 1.3.99.-)

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (3/9 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.1.62 or 1.3.99.-

Protein Sequence (379 amino acids)

>RALBFv3_RS02885 acyl-CoA dehydrogenase (Ralstonia solanacearum IBSBF1503)
MDFSFTDEQKQLADAVRRFIDKEYGFEARNKVVYSAEGVSQAHWDALAELGLTALPVPEA
QGGFDGRAMDLLVVMQELGRGLVVEPYAATVLGTQALKLAGGQEALLEPVAVGGLKLALA
FGEPQSRYELFNVTTRAMQQGGSWTLSGAKAVAVHGAQADKLVVSARTGRMDDGARDTSG
LSLFLVDRDAAGVTVKDYRTIDNLRAADIRFDHAPATLLGKAGEAWETIDAVADFGCVLL
CAEAVGLIDALNAATLEYTKTRQQFGVPIARFQALQHRMVDMFIHAEQARSITYLAAAHF
EDGDAEARRRYVSAAKARVGQAAREVGQEAVQLHGGMGVTNELPAAHMFKRLTMINTTLG
DVDHHLARFASLPGFRNAA