Protein Info for RALBFv3_RS02540 in Ralstonia solanacearum IBSBF1503

Annotation: nodulation factor ABC transporter ATP-binding protein NodI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01288: nodulation ABC transporter NodI
  • amino acids 19 to 321 (303 residues), 470.6 bits, E=9e-146
• PF00005: ABC_tran
  • amino acids 33 to 176 (144 residues), 118.8 bits, E=3e-38
• PF13304: AAA_21
  • amino acids 144 to 205 (62 residues), 38.1 bits, E=1.8e-13

Best Hits

Swiss-Prot: 96% identical to NODI_RALSO: Nod factor export ATP-binding protein I (nodI) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K09695, lipooligosaccharide transport system ATP-binding protein (inferred from 99% identity to rsc:RCFBP_11412)

Predicted SEED Role

"Nodulation ABC transporter, NodI"

Protein Sequence (321 amino acids)

>RALBFv3_RS02540 nodulation factor ABC transporter ATP-binding protein NodI (Ralstonia solanacearum IBSBF1503)
MRYEQPPGPGIGSTPILSVEGLCKRYGEQTVVDGLSFSVRRGQCFGLLGPNGAGKTTTLR
MLLGMTMPDAGTLQLCGETVPGHAHRARMRVGVVPQFDNLDPDFTVSENLHIFGRYFGLP
AATIRTRMPGLLEFARLEQKADAPVRALSGGMKRRLTVARALINDPDVLVMDEPTTGLDP
QARHLIWERLRSLLASGKTILLTTHFMEEAERLCDELCVIDNGRKIAQGKPHELIAREIG
CDVVEVYGDDLPALRTLLSPLAERVETSGETLFCYARDPQPLVAALRAQTETHAMPGLRY
LHRPANLEDVFLRLTGREMRD