Protein Info for RALBFv3_RS02380 in Ralstonia solanacearum IBSBF1503

Annotation: alkylhydroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 19 to 193 (175 residues), 235.8 bits, see alignment E=2.8e-74 PF02627: CMD" amino acids 57 to 135 (79 residues), 44.1 bits, see alignment E=8.5e-16 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 75 to 104 (30 residues), 34.5 bits, see alignment 1.1e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_11444)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>RALBFv3_RS02380 alkylhydroperoxidase (Ralstonia solanacearum IBSBF1503)
MTEPLRTYGFTNEPLEWKAWLDVVDLDRATPGQIAVLEESHPKAKTSDYYRFLVHRPEIL
RQRSAAFNAIMYAPGGLSRAERELASTVVSRVNGCVYCACVHAQRFEQLAKRNDVIRQVF
EDPRTAGTNARERAIAQCSIDLTLRPGDVRAEDLQPLQAAGLTDAEILDLIHAVAIFAWA
NRLMLNLGEPVFPGEAA