Protein Info for RALBFv3_RS02070 in Ralstonia solanacearum IBSBF1503

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 159 to 185 (27 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details PF01925: TauE" amino acids 13 to 266 (254 residues), 155.2 bits, see alignment E=1.2e-49

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 97% identity to rsc:RCFBP_11519)

Predicted SEED Role

"FIG00976792: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>RALBFv3_RS02070 sulfite exporter TauE/SafE family protein (Ralstonia solanacearum IBSBF1503)
MPLYEAGWLASAGLGSAVGLILALTGAGGAIVAVPLLIFGLHLSVSQAAPVALLAVGLSA
GLGAALGLREGKVRYKAAALMALCGVLLSPLGVWAAQRVPNTPLTLLFAVVLAYVAIRMF
RQARATTPAVPSPPPAAPPCNLDAVRGKLIWTLPCARTLASWGAAAGFLSGLLGVGGGFV
IVPALRRATDLPMQTIVATSLAVIALVSAGGVVASAIGGHVDWQIAVPFGAGALAGMLTG
RGFARHLAGPALQQSFAAFAAMVAIGLAVRVLA