Protein Info for RALBFv3_RS00670 in Ralstonia solanacearum IBSBF1503

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details PF02308: MgtC" amino acids 21 to 141 (121 residues), 119.6 bits, see alignment E=1e-38 PF21770: MgtC_SapB_C" amino acids 158 to 234 (77 residues), 40.6 bits, see alignment E=2.9e-14

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to rsc:RCFBP_11886)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>RALBFv3_RS00670 methyltransferase (Ralstonia solanacearum IBSBF1503)
MTLQAVAQFNAATLLDSFISLTAAFGLGSLIGFERQVRQRTAGLRTNALVAVSAAAFVDM
AAQIGSSADTTRVIAYVVSGVGFLGAGTIMKEGLNVRGLNTAATLWGSAAVGAAAGADLI
GQALMISIFVLASNILLRPVVDRINRTPLDNQASEVTYTVHAISTRERQKEALANLERLL
EEASYPISDLSVEPFGEDHVEMEAMLMSTAVNAGELDRIVGALAAQPHIAQAYWNPSTTE