Protein Info for RALBFv3_RS00195 in Ralstonia solanacearum IBSBF1503

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 108 to 269 (162 residues), 216.8 bits, see alignment E=8.3e-69 PF03167: UDG" amino acids 122 to 268 (147 residues), 137.7 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 95% identity to rsc:RCFBP_20062)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>RALBFv3_RS00195 uracil-DNA glycosylase (Ralstonia solanacearum IBSBF1503)
MNRRARMLEALGVSNEWRLRGVEPPAAPAIEAEMVAERVEVAVADEPAPLVIEPPVIEPR
VVVSEAEPPPMAPPAAPVADIPVAPELPRAQRIAAFDWAQLEAAVSGCTACKLCERRTQT
VFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSMLRAVGLSRETGVFIANVLKC
RPPGNRDPEPDEVAMCDPYLKRQIALVKPRVIIVLGRFAAQSLLQTQTPVGKLRGRVHEV
DGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYAERGGT