Protein Info for Psyr_5080 in Pseudomonas syringae pv. syringae B728a

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF25371: DUF7884" amino acids 11 to 78 (68 residues), 33.7 bits, see alignment E=1.4e-11 PF02353: CMAS" amino acids 99 to 373 (275 residues), 367.5 bits, see alignment E=1.7e-113 PF05175: MTS" amino acids 152 to 237 (86 residues), 24.9 bits, see alignment E=5.7e-09 PF13489: Methyltransf_23" amino acids 156 to 271 (116 residues), 36.8 bits, see alignment E=1.4e-12 PF13847: Methyltransf_31" amino acids 159 to 260 (102 residues), 36.8 bits, see alignment E=1.3e-12 PF13649: Methyltransf_25" amino acids 165 to 260 (96 residues), 65.3 bits, see alignment E=2.7e-21 PF08242: Methyltransf_12" amino acids 165 to 261 (97 residues), 47.1 bits, see alignment E=1.4e-15 PF08241: Methyltransf_11" amino acids 165 to 262 (98 residues), 52.1 bits, see alignment E=3.4e-17

Best Hits

Swiss-Prot: 76% identical to FAMT_PSEPU: Probable fatty acid methyltransferase from Pseudomonas putida

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to psb:Psyr_5080)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL65 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Psyr_5080 Cyclopropane-fatty-acyl-phospholipid synthase (Pseudomonas syringae pv. syringae B728a)
MLTQLPTTLQSLHLPLRLRLWDGHQMDLGPSPSVTIVVKDPQLVSDFSHPSLGLLGSAFV
EGRLELEGSISEVVRVCDELTHALVDDDDSAGNPVRVEHDKDTDAASIAYHYDVSNDFYQ
LWLDREMVYSCAYFKTGDESLEQAQQDKFHHLCRKLRLKRGEYLLDVGCGWGGLARFAAR
EYGVKVFGITLSQQQLALARERVQAEGLQDKVDLQLLDYRDLPQDARFDKVVSVGMFEHV
GHANLPLYAQRLFGAVKEGGLVMNHGITARHTDGRPVGRGAGEFIDRYVFPNGELPHMAM
ISAQISEAGLEVVDVESLRPHYAKTLEHWSARLEARLDEAARIVPEQTLRIWRLYLAGCA
YGFTKGWINLHQILAVKPFADGKTGLPLTREDIYG