Protein Info for Psyr_5031 in Pseudomonas syringae pv. syringae B728a

Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 18 to 293 (276 residues), 352.9 bits, see alignment E=7.1e-110 PF01040: UbiA" amino acids 34 to 279 (246 residues), 245.7 bits, see alignment E=2.4e-77

Best Hits

Swiss-Prot: 100% identical to UBIA_PSEU2: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 100% identity to psb:Psyr_5031)

MetaCyc: 78% identical to 4-hydroxybenzoate-polyprenyltransferase (Pseudomonas putida)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLB4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psyr_5031 4-hydroxybenzoate octaprenyltransferase (Pseudomonas syringae pv. syringae B728a)
MYLSLLKSLNRLSPRAWDFIQLTRIDKPIGVYLLLWPTLWAVWIAGKGAPSLQTVCIFVL
GVFLMRAAGCVINDFADRKVDGHVKRTEQRPLVSGKVSPREALVLFAVLVGLSFVLVLFT
NAATIWLSFGGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYI
ANLLWTVGYDTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFE
LGACFYIGLLAAAGCFAWEFWSTRERERDACFKAFLHNHWAGLAIFLGIVADYAVR