Protein Info for Psyr_4950 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase M48, Ste24p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 99 to 124 (26 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 185 to 201 (17 residues), see Phobius details amino acids 548 to 569 (22 residues), see Phobius details amino acids 582 to 601 (20 residues), see Phobius details PF01435: Peptidase_M48" amino acids 291 to 470 (180 residues), 54.1 bits, see alignment E=9.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4950)

Predicted SEED Role

"Zn-dependent protease with chaperone function"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLJ5 at UniProt or InterPro

Protein Sequence (723 amino acids)

>Psyr_4950 Peptidase M48, Ste24p (Pseudomonas syringae pv. syringae B728a)
MKIYKLIAVLILLPLGLNLIGVWQLQRSVENTERLTEIQADLAHARPYFERLARSPDALT
RTMEMDGENITLKEALSRLHEAEQGLDFVVVVGNVTTWLARAVIALCLLAALVGGIGLAG
LNWAGARALHSRERLLNTFSRVRRILPFVLVGHIIAMGTAVSAILCFEALGLWHVGRMSA
GELKLIIVVLMLVAACLYSIWRMGKQLGVMLHMFEPTAMEVLGQQVTPEEAPVLWAYVRD
LAERLGALSPDHIVLGMTEGFYVTSSDVSLLPSDIVLKGRTLHVPILYLGLIDAAETSAV
IGHELAHFAGEDTEYSLRFLPIYDGIGRSLGVIAENMMVSGWLQRTILRPAFMLGVYFME
SFDHAVNHWSRVRELAADAAGASLAGNASAASALVRISAIDPLLQERIYTHITRATNPRR
GEVFTKDLPNSVLHELAGKAFMLPDEEMAVQLPHPSDTHPSNGERIAALQVAADEAIRSG
IRPVVAAQARAAMDQYFSNAQALRTRLTEDFIKHHVANDAEVVTELRALAKTVSGDVVLH
EGARLRGLLLTLFLAPLLGLGIYLIAEALSFPQGLTEKRNSMLIAGGILTAFMLMLLPFA
LRMCLRADKTALLLTPEHFVFANLKSPVPIQHIADFELNVAYGTFLTLHLQDDAPLPERV
SRSFSAPNAKVFRKKRRVLLALARFSRDGKKLKPDELGELIADYVNAGTARHLLQQRFEQ
GKR