Protein Info for Psyr_4945 in Pseudomonas syringae pv. syringae B728a

Annotation: Formate dehydrogenase, subunit FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 36 to 272 (237 residues), 172 bits, see alignment E=6.9e-55 PF02634: FdhD-NarQ" amino acids 39 to 275 (237 residues), 222 bits, see alignment E=5e-70

Best Hits

Swiss-Prot: 42% identical to FDHD_BORPD: Sulfur carrier protein FdhD (fdhD) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to psb:Psyr_4945)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLK0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psyr_4945 Formate dehydrogenase, subunit FdhD (Pseudomonas syringae pv. syringae B728a)
MPVTRKVSSASFATPAPEASQSYSYSNLEGVDAARNELAEEVALAIAYNGISQAVMLVSP
TDLEDFIVGFSLGSGIIASHDEIYDFKISGCGSAMQAEVEIASRAFWELKQQRRQLAGTS
GCGLCGVEAVEQALPDLKALPGAPLPPIEWLEGLRQRIGEFQPLGRHCGAVHAAVFMDGN
GQLLLGREDIGRHNALDKLIGALIRQDIPLAGGVAIVTSRCSLELIQKVLRAGIQTLVSL
SSPTGLALQWARRHNLNLIHLPQKSAPRVYSPAMEIQA