Protein Info for Psyr_4933 in Pseudomonas syringae pv. syringae B728a

Annotation: Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR03381: N-carbamoylputrescine amidase" amino acids 5 to 282 (278 residues), 488.9 bits, see alignment E=2.2e-151 PF00795: CN_hydrolase" amino acids 7 to 266 (260 residues), 192.5 bits, see alignment E=4.5e-61

Best Hits

Swiss-Prot: 64% identical to AGUB_ORYSJ: N-carbamoylputrescine amidase (CPA) from Oryza sativa subsp. japonica

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 99% identity to pst:PSPTO_5394)

MetaCyc: 86% identical to N-carbamoylputrascine amidohydrolase subunit (Pseudomonas aeruginosa)
N-carbamoylputrescine amidase. [EC: 3.5.1.53]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLL2 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Psyr_4933 Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase (Pseudomonas syringae pv. syringae B728a)
MSRIVSVAATQMACSWDLEANIETAEKLVREAAAKGAQIILIQELFETPYFCQKPNPDYL
QLATTLESNVAIKHFQKIAKELQVVLPISFFELAGRARFNSIAIIDADGSNLGIYRKSHI
PDGPGYHEKYYFNPGDTGFKVWQTRYAKIGVGICWDQWFPECARSMALQGAEILFYPTAI
GSEPHDKTISSRDHWQRVQQGHAGANLMPLIASNRIGNEEQDGYDITFYGSSFIANQFGE
KVAELNETEEGVLVHSFDLDELEHIRSAWGTFRDRRPNLYGAVKTLDGSLES