Protein Info for Psyr_4883 in Pseudomonas syringae pv. syringae B728a
Annotation: Glutaredoxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to GLRX_PSEAE: Glutaredoxin (grx) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K03676, glutaredoxin 3 (inferred from 98% identity to psp:PSPPH_4914)MetaCyc: 55% identical to reduced glutaredoxin 3 (Escherichia coli K-12 substr. MG1655)
Protein-disulfide reductase (glutathione). [EC: 1.8.4.2]
Predicted SEED Role
"Glutaredoxin 3 (Grx3)" in subsystem Glutaredoxins or Glutathione: Redox cycle
MetaCyc Pathways
- L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.8.4.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZLR2 at UniProt or InterPro
Protein Sequence (83 amino acids)
>Psyr_4883 Glutaredoxin (Pseudomonas syringae pv. syringae B728a) MAQVIVYSSDYCPYCIRAKQLLQSKSVAFEEIRVDGKPQLRAEMTQKAGRTSVPQIWIGS THVGGCDDLFALERAGKLDALLA