Protein Info for Psyr_4805 in Pseudomonas syringae pv. syringae B728a

Annotation: YD repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1229 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details PF25799: prePAAR_I" amino acids 1 to 56 (56 residues), 76.8 bits, see alignment 3.9e-25 PF05488: PAAR_motif" amino acids 71 to 137 (67 residues), 69.5 bits, see alignment 6.4e-23 PF20148: DUF6531" amino acids 231 to 304 (74 residues), 72.8 bits, see alignment 7.2e-24 PF25023: TEN_YD-shell" amino acids 478 to 596 (119 residues), 37.3 bits, see alignment E=2.9e-13 amino acids 997 to 1207 (211 residues), 69.4 bits, see alignment E=5.7e-23 TIGR01643: YD repeat (two copies)" amino acids 526 to 565 (40 residues), 37.1 bits, see alignment (E = 1.4e-13) amino acids 578 to 608 (31 residues), 17.7 bits, see alignment (E = 2e-07) amino acids 643 to 672 (30 residues), 20 bits, see alignment (E = 3.7e-08) amino acids 677 to 713 (37 residues), 22.4 bits, see alignment (E = 6.3e-09) amino acids 736 to 775 (40 residues), 17.9 bits, see alignment (E = 1.7e-07) amino acids 858 to 893 (36 residues), 19.5 bits, see alignment (E = 5.3e-08) PF05593: RHS_repeat" amino acids 526 to 562 (37 residues), 31.7 bits, see alignment (E = 4.7e-11) amino acids 546 to 583 (38 residues), 28.2 bits, see alignment (E = 6.2e-10) amino acids 858 to 893 (36 residues), 25.3 bits, see alignment (E = 4.8e-09) PF03527: RHS" amino acids 1172 to 1205 (34 residues), 64.7 bits, see alignment (E = 1.6e-21)

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4805)

Predicted SEED Role

"Rhs family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLZ0 at UniProt or InterPro

Protein Sequence (1229 amino acids)

>Psyr_4805 YD repeat protein (Pseudomonas syringae pv. syringae B728a)
MFEAARLLDEIEHTGAMAGFVLGAIVGIAAVAYVSLTVATCGFGGFLLAMAVGLAGNAIA
SIGESIGSAFSSPAGQIESASPNVFINGRPAAFAIESTAVCDKHSPIVKVAEGSSNVFIN
GQPAARKGDKLTCGAKIGTGSPNVFIGGGTQRYLPVDDEVSAMARYTVDILLVVAGGAKA
VLSIAKLGMQAGLKAAGPCALQFMGGVFLGDAIFRFGVAPVAEKVLGGLHGNPVDTTTGR
KLLIDESDFSLPGLMPIEWTRFYASDLDVDSALGKGWVLPWEQSLRRKGSFLYLSDNQGR
SVPFVTLDYNQRIYNAQEQLYLVRTEGGHYLLQTLDNVFYYFGEVPDDNHPVPLQRVENA
LGHFLHFVRSEDGVLTDICATGGHRVHLHYDEVNSRLSTVKRIVGDQAVETLVRYGYDNN
GQLNSVYNRNGDSVRNFSYTDGLMTRHANALGLSCEYRWEVLDGKPRVVEHWTSDGEHFH
FDYDFEARQTRITDVLGRRAEVTYNKDRRVIASTDFGGEQYRIALDNTGNITGLTLPDGN
QLGFEYDDLSRLTAETDPLGRTTRYQHHYKTTLVKQITYPDGAVWTARYDSKGNLVAEID
ALGQKTEYLNSEDGLPHTIIDATYKSKYLWWNNLAQVERFQDCSGKSTWYRYDERDQLVA
VTDALNNTTTLERKPGGEVLSINHPDGTRESFTYNAHGQVLTHTNGKDQTTHLARNARGL
PIRRQDPKGLIVGYQYDKALRLAALINENDATYTFAYDDSDRLIEEKRIDQLTRRFSYNL
GGHLTQVEEIGYSEKGERPQRSTHFERDPIGRLLARLNDDARQDFTYDDSDRLLSIQRTP
TDGGRKLGVTAEKLEFAYDILGRLTQESSPKGTLAYEYDPLSNLTTLTLPTGQHLNHLYY
GSGHLHQLNLDGQLISDMERDDLHREIYRTQGKLTSCFGYDALGRKTWQYATTLPAEKLS
QIQNPLIKPERYVEHAYNPLHRRYEYDPAGELSRTLDKLRGEVTYEYEANGRLLEHNPEK
RFDGEEFRYDAAGNRLNFNTSRFDRVKDNRLKKWSNHEYKYDAWGNLVEKIVGIVRWQTF
TYDSENRLVKTETMANSQVESTSSYQYDSLGRRVAKQSDIKGKTDHRLFLWQGLRLLREE
SPGQSSLYLYEPGSYAPLARVDEKEGEAENKVYYFHTDQIGTPLEMTDAEGQIVWQAKYR
PWGAVEKLVVNDVEQNLRFQGQYMEILVR