Protein Info for Psyr_4754 in Pseudomonas syringae pv. syringae B728a

Annotation: 16S rRNA m(2)G-966 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 9 to 193 (185 residues), 179.7 bits, see alignment E=2.5e-57 PF03602: Cons_hypoth95" amino acids 15 to 192 (178 residues), 195.3 bits, see alignment E=1.1e-61 PF05175: MTS" amino acids 48 to 138 (91 residues), 36.9 bits, see alignment E=4.3e-13 PF13847: Methyltransf_31" amino acids 56 to 152 (97 residues), 28.7 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 52% identical to RSMD_ECOLI: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli (strain K12)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 100% identity to psb:Psyr_4754)

MetaCyc: 52% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM41 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Psyr_4754 16S rRNA m(2)G-966 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MANPRPKGHNGLGQLRIIGGEWGSRRLTFPDAPGLRPTPDRVRETLFNWLAPYIAGARVL
DVFTGSGALFFEALSRGASMGLALDSNAAAIASLRQNLNALNCTSGQVSQTDALRHLETA
AASPFDVVFLDPPFHQGLLASACNLLESHGWLADTAWIYTESETPPSTTGLPGTWRLHRE
KKAGQVYYALWQRGWA