Protein Info for Psyr_4718 in Pseudomonas syringae pv. syringae B728a

Annotation: glutathione-independent formaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR02819: formaldehyde dehydrogenase, glutathione-independent" amino acids 2 to 395 (394 residues), 753.3 bits, see alignment E=2.1e-231 PF08240: ADH_N" amino acids 35 to 145 (111 residues), 96.3 bits, see alignment E=9.8e-32 PF01262: AlaDh_PNT_C" amino acids 183 to 230 (48 residues), 23.2 bits, see alignment 4.3e-09

Best Hits

Swiss-Prot: 90% identical to FADH_PSEAE: Glutathione-independent formaldehyde dehydrogenase (fdhA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00148, glutathione-independent formaldehyde dehydrogenase [EC: 1.2.1.46] (inferred from 100% identity to psb:Psyr_4718)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM77 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Psyr_4718 glutathione-independent formaldehyde dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSCKEQNTGVCLTVNPARP
GGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLVHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVISLDDAPRGYGEFDSGVPKKFVIDPHGLFGAA