Protein Info for Psyr_4643 in Pseudomonas syringae pv. syringae B728a

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details PF04610: TrbL" amino acids 17 to 130 (114 residues), 66.7 bits, see alignment E=1.3e-22 TIGR02783: P-type conjugative transfer protein TrbL" amino acids 18 to 187 (170 residues), 137.8 bits, see alignment E=2.4e-44

Best Hits

KEGG orthology group: K03201, type IV secretion system protein VirB6 (inferred from 100% identity to psb:Psyr_4643)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZME9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psyr_4643 conjugal transfer protein (Pseudomonas syringae pv. syringae B728a)
MSILTTVSKPASSLYPVSTLILLTAIAVPVILALIALNMLLLLISAWLLAYAGIFLLGFG
GSQWTSDIAINYYKTVLGVGIQLFTMTFLIGVGKSFLDQYYQAFSVGTPDLNSLCVLLVA
SVVLLTLVNKLPPMLAGIISSGGQTSGIGSFGAGAAIGAATMAASTVASAASTALGGANE
IAGGTSALTAAFKAAEAHMDSGSTDTGNFEYGSGSEQQTTSGSGQSAFGQAMGNGQNTGY
ASRVAQTGRLAASAGALIAEQVGQSISSRASAAVSDTAGGRVAVSINDNSKTLHSDKTER
FDGDSVSGSDEFADFIDRDPTPD