Protein Info for Psyr_4637 in Pseudomonas syringae pv. syringae B728a

Annotation: acyl-phosphate glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 5 to 190 (186 residues), 178.6 bits, see alignment E=6.1e-57 PF02660: G3P_acyltransf" amino acids 11 to 184 (174 residues), 180.4 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 100% identical to PLSY_PSEU2: Glycerol-3-phosphate acyltransferase (plsY) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to psb:Psyr_4637)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMF5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psyr_4637 acyl-phosphate glycerol-3-phosphate acyltransferase (Pseudomonas syringae pv. syringae B728a)
MVRMFWLLTTFAYLLGSLSFAILLSRLSGRPDPRASGSGNAGATNMLRLAGKKLAILTLL
GDLCKGLVPILIASTLSMDIAQQGWIGVCAVLGHLFPVYFRFRGGKGVATAAGVLLGLYP
PAAALAIVAWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHALLPMSVLTLLIVWRHRGN
LRDLLAGRERHF