Protein Info for Psyr_4627 in Pseudomonas syringae pv. syringae B728a

Annotation: dimethyladenosine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 7 to 260 (254 residues), 283.2 bits, see alignment E=8.6e-89 PF00398: RrnaAD" amino acids 7 to 260 (254 residues), 233.8 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 100% identical to RSMA_PSEU2: Ribosomal RNA small subunit methyltransferase A (rsmA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 100% identity to psb:Psyr_4627)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMG5 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psyr_4627 dimethyladenosine transferase (Pseudomonas syringae pv. syringae B728a)
MTEQYQHRARKRFGQNFLHDAGVIDKILRAIRARPEDRLLEIGPGQGALTEGLLDSGAQL
DVVELDKDLIPILNGQFASKPNFNLHQGDALKFDFNTLGADPRSLRVVGNLPYNISTPLI
FHLLQNASLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIMVQYHCRVEHLFNVGPGAFNP
PPKVDSAIVRLVPYETLPHPAKDHRVLERIVREAFNQRRKTLRNTLKLLLTSDEITASGV
DGSLRPEQLDLAAFVRLADTLSEKVVTE