Protein Info for Psyr_4526 in Pseudomonas syringae pv. syringae B728a
Annotation: SSU ribosomal protein S11P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS11_PSEFS: 30S ribosomal protein S11 (rpsK) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 98% identity to pfv:Psefu_0663)MetaCyc: 79% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZMR6 at UniProt or InterPro
Protein Sequence (129 amino acids)
>Psyr_4526 SSU ribosomal protein S11P (Pseudomonas syringae pv. syringae B728a) MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNGCGYKIASITDVTPIPHNG CRPPKKRRV