Protein Info for Psyr_4505 in Pseudomonas syringae pv. syringae B728a

Annotation: carbohydrate ABC transporter ATP-binding protein, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00005: ABC_tran" amino acids 28 to 170 (143 residues), 119.7 bits, see alignment E=2.9e-38 PF17912: OB_MalK" amino acids 244 to 291 (48 residues), 27.3 bits, see alignment 1.1e-09 PF08402: TOBE_2" amino acids 286 to 345 (60 residues), 34.1 bits, see alignment E=4.9e-12

Best Hits

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 100% identity to psb:Psyr_4505)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMT7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Psyr_4505 carbohydrate ABC transporter ATP-binding protein, CUT1 family (Pseudomonas syringae pv. syringae B728a)
MNALTPITCAPDIILTDLHKTYGTEPILHGLDLVFKAGELNVILGPSGCGKSTLLRMVAG
LEEVSQGQILMGGRDVTRLPPKERGCAMVFQNYALYPHMSVADNIGYALTLARVARKERE
QRIRECAASLGLEELLQRKPGELSGGQRQRVAIGRALIRKPPVLLFDEPLCNLDSALRHE
MRLLIRSLHRQTGATILYVTHDQTEAMTLAERVVILDKGRVEQIGTPAQIYDKPASTFVA
SFIGTPPMNLLPVHCLDDKILMLADGQRLPIKLGIASNRTGKWLMGLRPETFMLDQQGVT
ATVESSENLGSHTLLYCQLAGTRCVVSLAGRQHQIPGTQVRLAINSTPLLFDIETGQRQL
VTFSHTTK