Protein Info for Psyr_4429 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 45 to 286 (242 residues), 388.3 bits, see alignment E=7.5e-121 PF00005: ABC_tran" amino acids 61 to 216 (156 residues), 100.7 bits, see alignment E=1.6e-32 PF12399: BCA_ABC_TP_C" amino acids 264 to 286 (23 residues), 29.8 bits, see alignment (E = 5.4e-11)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_4429)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN13 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psyr_4429 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MKTTPTPSFMLEPILAPNSDAGTSRDAVGLGKSAGKGLNTRHGTILTLEDISVSFDGFKA
LNDLNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGKAWFGETLDLTKMTEVQIAQ
AGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRAQLSGEQQDRIGEVLETIRLTSS
MHRPAGLLSHGQKQFLEIGMLLVQDPQLLLLDEPVAGMTDAETEFTAELFKSLAGKHSLM
VVEHDMGFVGSIADHVTVLHQGSVLAEGSLNDVQADERVIEVYLGR