Protein Info for Psyr_4418 in Pseudomonas syringae pv. syringae B728a

Annotation: Precorrin-6Y C5,15-methyltransferase (decarboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF00590: TP_methylase" amino acids 5 to 189 (185 residues), 59.4 bits, see alignment E=2.6e-20 TIGR02467: precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit" amino acids 7 to 192 (186 residues), 148.4 bits, see alignment E=1.8e-47 TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit" amino acids 230 to 351 (122 residues), 116.1 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 71% identical to COBL_PSEAE: Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] (cobL) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00595, precorrin-6Y C5,15-methyltransferase / precorrin-8W decarboxylase [EC: 1.-.-.- 2.1.1.132] (inferred from 100% identity to psb:Psyr_4418)

MetaCyc: 51% identical to precorrin-6B (C5,15) methyltransferase subunit (Pseudomonas denitrificans (nom. rej.))
Precorrin-6Y C(5,15)-methyltransferase (decarboxylating). [EC: 2.1.1.132]

Predicted SEED Role

"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.132

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN24 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Psyr_4418 Precorrin-6Y C5,15-methyltransferase (decarboxylating) (Pseudomonas syringae pv. syringae B728a)
MSPWLTVVGIGEDGYKGLGKNARHALLHADQVFGGPRQLALLPPCIRAERRAWPSPFSLS
PVLEQRGAEICVLASGDPMMFGVGASLARVVSIDEMRILPAPSSYSLAAARLGWPLQDVV
TLSVVARPVAALNAHFHHGMRLLVLSNDGSSPAVIAGLLRERGFGPSRMTVLEHLGGEAE
RRVEGLASEWGNPEIAALNLVAIDCRADASAIRLSPVSGLPDSAFEHDGQLTKRDVRAIT
LARLAPLPGELLWDVGAGCGSIGIEWMRAHPTCRAMAIEADEGRQQLIEFNRDALGVPGL
QLVRGSAPQALSGLERPDAIFIGGGVTRIGVLETCWEQLRPGGRLVANAVTLQSETALMA
WRERHGGELTRIHVAHAQPLGEFDTWRQALPITLLDVVKP