Protein Info for Psyr_4417 in Pseudomonas syringae pv. syringae B728a

Annotation: Ferredoxin--nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR02435: precorrin-3B synthase" amino acids 15 to 406 (392 residues), 458.3 bits, see alignment E=1.1e-141 PF03460: NIR_SIR_ferr" amino acids 33 to 79 (47 residues), 40 bits, see alignment 2.6e-14 amino acids 268 to 334 (67 residues), 63 bits, see alignment E=1.8e-21 PF01077: NIR_SIR" amino acids 100 to 241 (142 residues), 69.7 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 100% identity to psb:Psyr_4417)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN25 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Psyr_4417 Ferredoxin--nitrite reductase (Pseudomonas syringae pv. syringae B728a)
MNEQQSARTSSATLRPSACPGLLRIVPALDGGICRIKLAGGVISSAQAMAVAEAARTYAQ
GVIEATNRANLQIRGIGADHDGLIGALMAAGLGPANPASDDVRNLMLSPTAGLDPQMLFD
ARPLAAQILDALEHHPRFHELSPKFALSLDAGEALVMLEHPHDVWLSALKRDDEVLLAFG
LAGCPAHDRPLAAVPLAEGKMLVVALLELFLDLARPEHTRMRHLLTEVSTADLLRELSTR
SACTVRTDKAITDWQRPAIQGTRHIGVYPQAQPNQVAVGAAVPLGRLDAAMLCSVAQLAA
DQGDGTLRLTPWQSLLLPNVPVERAAAVLDELQASGFAGSAEQPLAQMLACTGSAGCAKG
LADTKADALQLAAALDTGQAIHLSGCTRSCAAAHVAPVTLLAVAPGRYDLYFRDAAHAGF
GVLRARNLTIEAVGAQLNAGSRSNMHD