Protein Info for Psyr_4403 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 286 to 306 (21 residues), see Phobius details TIGR02098: MJ0042 family finger-like domain" amino acids 6 to 41 (36 residues), 56.7 bits, see alignment 7e-20 PF13719: Zn_ribbon_5" amino acids 6 to 41 (36 residues), 36.2 bits, see alignment 6.2e-13 PF13717: Zn_ribbon_4" amino acids 7 to 40 (34 residues), 34.9 bits, see alignment 1.7e-12 PF11906: DUF3426" amino acids 291 to 436 (146 residues), 160.4 bits, see alignment E=5e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4403)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN39 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psyr_4403 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MTDSFVTQCPHCQTSFRVSHAQLSVARGVVRCGACLQVFNAARQLLEQRASDDAEKEALP
ASPVVAALPEPEFLPTPVPEPELKPQPEPEKLPEEDDPWQVSELDLDNLNLDEELARLEQ
RETRRPDTFARPVSDIGNDDVSLTAKRDSRQSDEAAWVDTLHNDDVEQLPELHAEVIADT
DPAEAAEPPEDDKRTEPSLSLDNDLDDDEPPMPVIIQRKAPPAEKVERWSAVDDDDEDHD
HEPEPETRGKRSRNEPAVRDQTLLDLTDDPLQLDWQRPKPRWGRRLAWGLLIVLALTGLA
GQYVWYHFDQLARQDQYRPLFQQICPQVGCKVPSKVDISQLKSSNLVVRSHPEFQGALVV
DAIIYNRASFSQPFPLLELRFSDTGGQLIASRRFKPSEYLSGEMAGKEEMPPQTPIHIAL
DILDPGAKAVNYSLNFRSPE