Protein Info for Psyr_4394 in Pseudomonas syringae pv. syringae B728a

Annotation: type II secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 26 (4 residues), see Phobius details amino acids 75 to 109 (35 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00482: T2SSF" amino acids 128 to 253 (126 residues), 65.1 bits, see alignment E=3.2e-22

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 100% identity to psb:Psyr_4394)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN48 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psyr_4394 type II secretion system protein (Pseudomonas syringae pv. syringae B728a)
MSASLVLGLISLLLFIASIRMFYLALNQGASERVRQRLMAGQVQPVAEKTGWSYLDRAFL
RAGLGQPTKRMGLALSLYALLILIGYAMAGVVGALSVLLAVPLTLRVFVSWRYEVRVRRM
IQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPDAARDF
AELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETRMTAVV
LALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLWRMLRSI