Protein Info for Psyr_4368 in Pseudomonas syringae pv. syringae B728a

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to NADD_PSEU2: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to psb:Psyr_4368)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

aspartate superpathway (22/25 steps found)
NAD de novo biosynthesis I (5/6 steps found)
NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
NAD de novo biosynthesis III (4/6 steps found)
NAD salvage pathway II (PNC IV cycle) (3/5 steps found)
NAD salvage pathway V (PNC V cycle) (3/5 steps found)
NAD salvage (plants) (5/11 steps found)
NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)
superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN74 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_4368 nicotinate-nucleotide adenylyltransferase (Pseudomonas syringae pv. syringae B728a)
MTALPRRIGMLGGTFDPVHIGHLRGALEVAELLELDELRLTPSARPPHRDMPSVTAEDRL
AMVQSAVAGVSPLTVDDRELKRDKPSYTLDTLESMRAELAPRDQLFLLLGWDAFCGLPTW
HRWEELLEHCHIVVLQRPDADSESPDAMRNLLAARAVSDPKALKGPGGQITFVWQTPLSV
SATQIRQLLASGKSVRFLVPDAVLAYIDARGLYRAPNTDGSS