Protein Info for Psyr_4350 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF218

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 57 (24 residues), see Phobius details PF02698: DUF218" amino acids 81 to 244 (164 residues), 107.7 bits, see alignment E=2.2e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4350)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN92 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Psyr_4350 Protein of unknown function DUF218 (Pseudomonas syringae pv. syringae B728a)
MPLRYLLKTLLLPPGILFVLLILGWWLRRSRPRLATAFFAVGLGGLWLMSLPVAVEFAAR
RLEQIPPLPQQRWAMLAQQADAIVVLGNGRERNSPTWGTDTPTGLGLERLRLAARLAKES
GLPILTSGGLHFDQPPSEAAIMAQSLQDDFAVTVRWQEGLSRTTWENATMSAAILQPQGI
KRVVLVTQAWHMPRARWSFEQAGFTVVGAPVGFLGVDNARPFGGWLPESRVFTQSGMLLN
EAAGLLVYPWVYRKGQ