Protein Info for Psyr_4339 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase A, N-terminal:Histidine kinase:Histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 196 to 218 (23 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 45 to 184 (140 residues), 141.7 bits, see alignment E=3e-45 PF07695: 7TMR-DISM_7TM" amino acids 197 to 399 (203 residues), 181.2 bits, see alignment E=4.9e-57 PF00512: HisKA" amino acids 432 to 496 (65 residues), 51.6 bits, see alignment E=1.6e-17 PF02518: HATPase_c" amino acids 543 to 657 (115 residues), 75.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4339)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNA3 at UniProt or InterPro

Protein Sequence (677 amino acids)

>Psyr_4339 ATP-binding region, ATPase-like:Histidine kinase A, N-terminal:Histidine kinase:Histidine kinase (Pseudomonas syringae pv. syringae B728a)
MDGLNATTYLGASMRYLLIILALWLPLQSHAVEFDENTRFLPLGRAIQVFEDPTGEATIE
SVSAAAHASAFKPVPPGTFNAGYSRSAFWLKVELTYRPTDASIHNDWLLELAYPPMDHID
FYGPDADGQPTRAWHTGDMLPFSSRQFAQNNYLFQLDLPPGQTRTLYMRIRSEGAVQAPL
YLWSTHAYMDAQPTKIYVFGLIYGVLLGMLVYNLFIYLSVREVDYLYYLLYVASFGLYQM
SINGVAIEYLWPDSPWWANASTPFLISLATLFACQFSRSFLGTAQLSRWLDRLLLAVIGA
AVLVMGMALFLSYGPALRGAAQLVMAGALTIYLAGIVAVIKGERVGRYFVLAWSVFMVSG
LIFGLMLLGYLPNTFLTMYASHIGTVLEMAFLSMALADRINHARRQQAQTLLAAGQDLER
LNQQLANSNRLKDEFLATLTHELRTPMNGVIGSLEVMQTLDMDDEVEMYQQTAASSARDM
MSMINGILTLTELQAGVLYADCEAFSPKDLADRLRERFSGAAQSKGLILTLDLDDKLPPS
LRGDAGKLYQCIECLVDNAIKFTRKGAVQVRFSGHPQDLERLYLRVEVMDSGIGLSCLDE
AGLYQHFFQVDGSMTREYGGLGIGLAICRKLIELQGGELSHRSEPGKGSCFTLSVPMLMV
VPGAVRRAPELKAQWGI