Protein Info for Psyr_4303 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0259

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 12 to 20 (9 residues), see Phobius details amino acids 36 to 36 (1 residues), see Phobius details transmembrane" amino acids 21 to 35 (15 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details PF06790: UPF0259" amino acids 64 to 212 (149 residues), 39.3 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4303)

Predicted SEED Role

"FIG00958173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZND9 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_4303 Protein of unknown function UPF0259 (Pseudomonas syringae pv. syringae B728a)
MNPLNIIQDSLYFFRRNLGSIALLCLPVVILEVLAKQALGSAMSADTSPAYALVIGLFFY
PIYTAALILFLDARSRGEDVHTRDVLAMAVRLWPTFAVLSAMSTLLIMFGLSLFVLPGIW
VMIKLAFSEYLLVLRKLTPFMAMRESMQMTTGHFTRILVCVLSVYIPLWLLEGASLYLFP
EPQSAAVSVITDSIGSFLQLFTTIVTFRLFMLISEPAHRA