Protein Info for Psyr_4252 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 40 to 67 (28 residues), see Phobius details amino acids 89 to 119 (31 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 205 to 231 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 60 to 227 (168 residues), 73.4 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 64% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 99% identity to pst:PSPTO_4578)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNJ0 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psyr_4252 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MANRYGKGLLGGAVTIALLALLIHWIGISTIKQYQDDLLFYLQAHLILVLVSMLAALVVG
IPAGIALSRPSMVGRAERFMQIFNIGNTVPPLAVLAIALGILGIGSGPAIFALFLASLLP
IVRNTYEGLKNVQGSLKEAAVGIGMTPRQVLWRVELPNAVPIIIGGVRVALAINVGTAPL
AFLIGANSLGSLIFPGIALNNQPQLVLGAACTALLALLLDGLVTLASRLWLERGLAR