Protein Info for Psyr_4212 in Pseudomonas syringae pv. syringae B728a

Annotation: Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00005: ABC_tran" amino acids 35 to 185 (151 residues), 107.9 bits, see alignment E=6.3e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 320 (86 residues), 97.1 bits, see alignment E=2.5e-32 PF08352: oligo_HPY" amino acids 237 to 302 (66 residues), 76.9 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_4212)

Predicted SEED Role

"Peptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNN0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psyr_4212 Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal (Pseudomonas syringae pv. syringae B728a)
MSGPILLNVNDLVVRFPAPGSGFMGLNKRWVHAVNGVSLSICAGETLGLVGESGSGKSTL
GRAILRLNDITSGQIVFDDVDMAQGSGINLQRLRSETAMVFQDPSSSLNPRMTIGATLAE
VLAVQRKVATSDIPARVTELLDMVGLRPEFAERKPGALSGGQCQRVGIARALAIEPRLII
ADECVAALDVSIQGQIINLLLELRQRMNLAILFIAHDLAIVRRLCDRVAVMYLGRIVEEG
PVEDVFVSPRHPYTAALIQAIPEIDPDRPLLGEPLQGEPPSPLNLPDGCAFHPRCRFARP
TCSSVAPPTRHVGQQRYDCVLEAPVF