Protein Info for Psyr_4187 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protease FtsH catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 98 to 120 (23 residues), see Phobius details PF06480: FtsH_ext" amino acids 5 to 93 (89 residues), 61 bits, see alignment E=3.5e-20 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 99 to 595 (497 residues), 783.4 bits, see alignment E=4.6e-240 PF06068: TIP49" amino acids 149 to 223 (75 residues), 26.5 bits, see alignment E=1.1e-09 PF07728: AAA_5" amino acids 189 to 311 (123 residues), 24.9 bits, see alignment E=5.2e-09 PF00004: AAA" amino acids 190 to 322 (133 residues), 162.4 bits, see alignment E=2.3e-51 PF17862: AAA_lid_3" amino acids 345 to 388 (44 residues), 46.9 bits, see alignment 4.7e-16 PF01434: Peptidase_M41" amino acids 403 to 594 (192 residues), 241.7 bits, see alignment E=1.8e-75

Best Hits

Swiss-Prot: 67% identical to FTSH_SALTY: ATP-dependent zinc metalloprotease FtsH (ftsH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to psb:Psyr_4187)

MetaCyc: 67% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNQ5 at UniProt or InterPro

Protein Sequence (634 amino acids)

>Psyr_4187 membrane protease FtsH catalytic subunit (Pseudomonas syringae pv. syringae B728a)
MAKNLILWLIIAAVLVTVMNNFSSPNEPQNLNYSEFIQQVKDGKVEKVSVDGYVITGKRS
DGDTFKTIRPNIPDNGLIGDLVSNNVVIEGKQPEQQSIWTQLLVASFPILVIIAVFMFFM
RQMQGGAGGKGGPMSFGKSKARLLSEDQVKTTLADVAGCDEAKEEVGELVEFLRDPGKFQ
RLGGRIPRGVLMVGPPGTGKTLIAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFE
QAKKHAPCIIFIDEIDAVGRHRGAGMGGGHDEREQTLNQLLVEMDGFEMNDGIIVIAATN
RPDVLDPALLRPGRFDRQVVVGLPDIRGREQILKVHMRKVPMGEDVNPGVIARGTPGFSG
ADLANLVNEASLFAARSGKRVVEMKEFELAKDKIMMGAERKSMVMSDKEKRNTAYHEAGH
AIVGRLVPEHDPVYKVSIIPRGRALGVTMFLPEEDRYSLSKRALISQICSLYGGRIAEEM
TLGFDGVTTGASNDIMRASQIARNMVTKWGLSEKLGPLMYSEDEDAGYLGRGGSQNSSVS
GDTAKLIDSEVRSIIDHCYGTAKQLLTDNRDKLEAMADALMKYETIDADQIDDIMTGRTP
REPRDWGGGSGTNGTPITPDPRPETPIGGPAAEH