Protein Info for Psyr_4186 in Pseudomonas syringae pv. syringae B728a

Annotation: Dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR01496: dihydropteroate synthase" amino acids 24 to 278 (255 residues), 330 bits, see alignment E=5.7e-103 PF00809: Pterin_bind" amino acids 25 to 264 (240 residues), 274.9 bits, see alignment E=3.3e-86

Best Hits

Swiss-Prot: 57% identical to DHPS_ECOL6: Dihydropteroate synthase (folP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 100% identity to psb:Psyr_4186)

MetaCyc: 57% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNQ6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Psyr_4186 Dihydropteroate synthase (Pseudomonas syringae pv. syringae B728a)
MTSALYPTRLPCGNRVLDLAHTHVMGILNATPDSFSDGGRYSQLDAALRHAEAMVQAGAT
LIDIGGESTRPGARPVSASEEVERVAPLVEVIARELDVIISVDTSTPEVMLATAGLGAGL
INDVRSLQRPGALEAAASTGLPVCLMHMLGEPGTMQNDPHYDDLVGEVCAFLAERMKQCI
AAGIGQQQIILDPGFGFAKTLEHNLSLFKHMEALHALGRPLLVGVSRKSMIGAVLGRPVD
QRLSGGLALAVLAMAKGARILRVHDVAETADVVRMIAAVEAAE