Protein Info for Psyr_4147 in Pseudomonas syringae pv. syringae B728a

Annotation: RNA polymerase, sigma 54 subunit, RpoN/SigL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00309: Sigma54_AID" amino acids 19 to 62 (44 residues), 64.1 bits, see alignment 1.2e-21 TIGR02395: RNA polymerase sigma-54 factor" amino acids 24 to 508 (485 residues), 510.4 bits, see alignment E=2.3e-157 PF04963: Sigma54_CBD" amino acids 144 to 337 (194 residues), 215.5 bits, see alignment E=7.7e-68 PF04552: Sigma54_DBD" amino acids 351 to 509 (159 residues), 231 bits, see alignment E=8.7e-73

Best Hits

Swiss-Prot: 90% identical to RP54_PSEPU: RNA polymerase sigma-54 factor (rpoN) from Pseudomonas putida

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 100% identity to psb:Psyr_4147)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNU5 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Psyr_4147 RNA polymerase, sigma 54 subunit, RpoN/SigL (Pseudomonas syringae pv. syringae B728a)
MAHARRRIRCLAPAMKPSLVLRMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALESNPM
LERQEEGDDFDHSDPLADNIEQKPNPDVQEPTYQESAPTVDNLEEGEWNERIPNELPVDT
AWEDIYQTSASSLPSNDDDEWDFTTRTSVGESLQSHLLWQLNVAPMSDKDRLVAVTLIDC
INNQGYLDETLDEILESFDPELDIELDEIEAVLHRIQQFEPAGIGARNLSECLLLQLRQL
PAKTPWLTEAQRLVSDYIDLLGSRDYGQLMRRMKLKEDELRQVIELVQSLNPRPGSQIES
TEAEYVIPDVIVRKDNERWLVELNQESVPRLRVNPQYAGFVRRADTSADNTFMRNQLQEA
RWFIKSLQSRNETLMKVATQIVEHQRGFLEYGDEAMKPLVLHDIAEAVGMHESTISRVTT
QKFMHTPRGIYELKYFFSSHVSTSEGGECSSTAIRAIIKKLVAAENQKKPLSDSKIAGLL
EAQGIQVARRTVAKYRESLGIAPSSERKRLM