Protein Info for Psyr_4106 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF01225: Mur_ligase" amino acids 26 to 94 (69 residues), 33.4 bits, see alignment E=7.2e-12 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 30 to 448 (419 residues), 452.5 bits, see alignment E=7.5e-140 PF08245: Mur_ligase_M" amino acids 108 to 296 (189 residues), 160.2 bits, see alignment E=1e-50 PF02875: Mur_ligase_C" amino acids 327 to 437 (111 residues), 64.1 bits, see alignment E=3.6e-21

Best Hits

Swiss-Prot: 43% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to psb:Psyr_4106)

MetaCyc: 43% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNY6 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Psyr_4106 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Pseudomonas syringae pv. syringae B728a)
MLKPMTFRELVVPLDARLVGGDCSFAGVSTDSRGIEPGQLFVALTGPRFDGHEYLDQVAA
KGAVGALVEREVQGAALPQLVVLDTRKALAQLGAMNRNAFVDRPVAAVTGSSGKTTVKEM
LASILRTRGPVLATRGNLNNELGVPLTLLELAPEYTSAVIELGASRVGEIAYTVSLAKPH
VAMITNAGTAHVGEFGGPDRIVEAKGEILEGLDAGGTAVLNLEDKAFPIWRKRAGNRNIL
TFALTDSAADVYASELSRDARGCPAFNLNSPLGTARVQLNLLGTHNVSNALAAAAAGCAM
GVPLEGIVTGLNNVQPVKGRAVAQIASNGTRVIDDTYNANPASINAAVDILTGFTGRTVL
VLGDIGELGDWAEQGHREVGAYAAGKVSALYAVGPLMTHAVSAFGEHAYHFASQAELIAA
LGAEQDPDTTLLIKGSRSAAMEHVVAALCGSSLEKH