Protein Info for Psyr_4101 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF01225: Mur_ligase" amino acids 18 to 116 (99 residues), 104.3 bits, see alignment E=5.4e-34 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 18 to 467 (450 residues), 553.7 bits, see alignment E=1.8e-170 PF08245: Mur_ligase_M" amino acids 121 to 301 (181 residues), 91.3 bits, see alignment E=1.2e-29 PF02875: Mur_ligase_C" amino acids 323 to 458 (136 residues), 57.5 bits, see alignment E=3.9e-19

Best Hits

Swiss-Prot: 100% identical to MURC_PSEU2: UDP-N-acetylmuramate--L-alanine ligase (murC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to psb:Psyr_4101)

MetaCyc: 61% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNZ1 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psyr_4101 UDP-N-acetylmuramate--L-alanine ligase (Pseudomonas syringae pv. syringae B728a)
MVENQRAMPQPEMRRIRRIHFVGIGGVGMCGIAEVLLNLGYEVSGSDLKGSAVTERLESF
GAQIFIGHRAENTIGADVLVVSSAVNTSNPEVATALERRIPVVPRAEMLAELMRYRHGIA
VAGTHGKTTTTSLIASVFAAGGLDPTFVIGGRLNAAGTNAQLGTSRYLIAEADESDASFL
HLQPLVAVVTNIDADHMATYEGDFNKLKKTFVEFLHNLPFYGLAVMCIDDPVVREILPLV
KRPTLTYGFSESADIRAINVRQDGMLTFFTVLRRDREPLDVSVNMPGNHNVLNSLATIAI
ATDEGVSDEAIVQGLSGFQGVGRRFQVYGELPVDGGHVMLVDDYGHHPREVAAVINAVRG
GWPDRRLVMVYQPHRFSRTRDLYDDFVQVLADANVLLLMEVYPAGEEPIPGADSRNLCHS
IRQSGQLDPIYIERGVELAPLVKPLLRAGDILLCQGAGDIGGLAPQLLKSPLFAGAKVAS
TEGKLK