Protein Info for Psyr_4080 in Pseudomonas syringae pv. syringae B728a

Annotation: Rhs element Vgr protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 TIGR03361: type VI secretion system Vgr family protein" amino acids 20 to 508 (489 residues), 497.5 bits, see alignment E=4.1e-153 TIGR01646: Rhs element Vgr protein" amino acids 31 to 517 (487 residues), 386.9 bits, see alignment E=1.6e-119 PF05954: Phage_GPD" amino acids 37 to 345 (309 residues), 334.5 bits, see alignment E=1.2e-103 PF04717: Phage_base_V" amino acids 397 to 463 (67 residues), 56.6 bits, see alignment 5.4e-19 PF13296: T6SS_Vgr" amino acids 490 to 597 (108 residues), 114 bits, see alignment E=7.2e-37 PF10106: DUF2345" amino acids 626 to 769 (144 residues), 145.8 bits, see alignment E=1.8e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4080)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP12 at UniProt or InterPro

Protein Sequence (853 amino acids)

>Psyr_4080 Rhs element Vgr protein (Pseudomonas syringae pv. syringae B728a)
MLKDLTALFAPQNRRLIKLTTVARDEQELLLESFSGTESLSELFSFELSMISRDAGLELK
SQIGQPAQLAIELATGESRYINGYISAFSLEGSDGGLARYSATLSPWLWMLSRRVDSRIF
QEQTIEAVIRTVFAAYGALPDFEFQLSQPLKTHSYITQYRESDLTFVLRLLEHEGLFFYF
DHNQEKHTLIILDHSRDLSPLPQQPTIRYHSASVTETADSITEWRSHRRLQSGRMSIQTF
DYKQPRNSLPVGMPSLNEQGNVDSYEVYDVLDHYSHGTFKDGERLVRQRLEAIEVQGKTF
TGNSNCRAMYPGHTFELTQHFDHDRGSAEDRSFLLITVKHEGSNNYLSDEGAGYTNEFVC
IRHKIPYRHPITVPRPSINGPLSAIVVGPDGEEVFTDELARIQVRFHWQRGDSLPQGTTW
LRVAMPSAGSGFGHQFMPRIGQEVLVTFLAGDIDRPLVTSVLYNNINLPPRFSKASGLPG
NRTLSGIRTQEHKGSGFNELLFDDTPGSLRARMGTTHQATALNLGKLTDPRTDGTAQPRG
NGAELRTDAAIALRAAQGMLLTTYARTDAKGSQLDREELLKLLAECGELFKSLGETAAAR
GSQAVDVKGMEALRQSLDQWPAPDNNGLGDPVLAMTAVAGIASATPRSQVHYAGENHDTT
AQDNLQLTSGAAMHLQAGKGLSAFAQDAGISAIANRGKVLVQAQEDDIALNAQKNLHVSA
VEGEVVITAPTIRLVADDGSYIKIGGGVEIGSQGKVTVHASEHDWIGPKTDSAAIPSFGR
DPAAQQVTFHYPGHSEQSPRAAADHSYEIKLEDGSLVKGMTNADGLTERVEREMMHQAQV
SALRSGTPKGGAQ