Protein Info for Psyr_4058 in Pseudomonas syringae pv. syringae B728a

Annotation: Lysine exporter protein (LYSE/YGGA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details PF01810: LysE" amino acids 15 to 198 (184 residues), 150.5 bits, see alignment E=2.1e-48

Best Hits

Swiss-Prot: 44% identical to ARGO_KLEP3: Arginine exporter protein ArgO (argO) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to psb:Psyr_4058)

MetaCyc: 46% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325

Predicted SEED Role

"Lysine efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP34 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Psyr_4058 Lysine exporter protein (LYSE/YGGA) (Pseudomonas syringae pv. syringae B728a)
MWQSYFNGLLIAAGLIMAIGSQNAFVLAQGLRREHHVSVAMLCIICDAILVAAGVFGLAN
VLAQNPTLLAVARWGGVLFLSWYGVQALRRACSKQSLEHGAAAGKRSRRTVLLSALAVTL
LNPHVYLDTVLLIGSLGAQQSVPGAYVAGAASASLLWFSCLAIGAAWLAPWLARPATWRL
LDVMVAVMMFSVAWQLIRSA