Protein Info for Psyr_4006 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 160 to 180 (21 residues), see Phobius details PF00440: TetR_N" amino acids 16 to 62 (47 residues), 63.7 bits, see alignment 1.7e-21 PF08361: TetR_C_2" amino acids 84 to 204 (121 residues), 111 bits, see alignment E=5.8e-36 PF13977: TetR_C_6" amino acids 125 to 202 (78 residues), 30 bits, see alignment E=7.8e-11

Best Hits

Swiss-Prot: 70% identical to TTGR_PSEPT: HTH-type transcriptional regulator TtgR (ttgR) from Pseudomonas putida (strain DOT-T1E)

KEGG orthology group: K03577, TetR/AcrR family transcriptional regulator, acrAB operon repressor (inferred from 100% identity to psb:Psyr_4006)

Predicted SEED Role

"Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP86 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Psyr_4006 transcriptional regulator, TetR family (Pseudomonas syringae pv. syringae B728a)
MVRRTKEEAQITRSQILEAAEQAFYERGVARTTLADIATLAGVTRGAIYWHFNNKADLVQ
AMLDSLQEPLDEMAQASQSEEEEDPLGCMRNLLIHLFHELALDPKTRRINEILFHKCEFT
DEMCDFRRQRQDNAIQCHDRITLGLNNAVRQGQLPKRLDTARAAVALFAYVNGIIYQWLL
VPDSFSLPAEAEQLVDVCLDMLRFSPTLLIDNNRSTVGA