Protein Info for Psyr_3973 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details signal peptide" amino acids 31 to 34 (4 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 261 (169 residues), 71.4 bits, see alignment E=4.3e-24

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to psb:Psyr_3973)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPB9 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psyr_3973 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MRLINRHPDRAGRLILVILPFALLLFAYFMGSATRLAENPSDKLLPSAVQMADAVKRMAF
VADPRSGDYLLWQDSASSLQRLAIGLGISALLGLCLGIAAGILPLCGAPLSPLLTVLSMV
PPLAILPILFIVFGLGELSKVMLIVIGITPILARDLEQRAREIPVELLIKAQTLGASTWT
LILRVILPQLLPRLLIALRLVLGSAWLFLIAAEAIASTDGLGYRIFLVRRYLAMDVILPY
VVWITLLAWLMDWGLKALTRRAFPWYEGARA