Protein Info for Psyr_3955 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase S1, chymotrypsin:PDZ/DHR/GLGF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 32 to 477 (446 residues), 520.7 bits, see alignment E=1.6e-160 PF00089: Trypsin" amino acids 102 to 261 (160 residues), 66.9 bits, see alignment E=8.2e-22 PF13365: Trypsin_2" amino acids 105 to 238 (134 residues), 130.8 bits, see alignment E=2.4e-41 PF00595: PDZ" amino acids 273 to 334 (62 residues), 36.8 bits, see alignment E=1.4e-12 amino acids 389 to 464 (76 residues), 24.8 bits, see alignment E=7.9e-09 PF13180: PDZ_2" amino acids 279 to 368 (90 residues), 59.1 bits, see alignment E=1.5e-19 amino acids 393 to 472 (80 residues), 33.9 bits, see alignment E=1.1e-11 PF17820: PDZ_6" amino acids 304 to 357 (54 residues), 40.5 bits, see alignment 6.5e-14 amino acids 419 to 468 (50 residues), 32.8 bits, see alignment 1.6e-11

Best Hits

Swiss-Prot: 97% identical to DEGPL_PSE14: Probable periplasmic serine endoprotease DegP-like (mucD) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to psb:Psyr_3955)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPD7 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Psyr_3955 Peptidase S1, chymotrypsin:PDZ/DHR/GLGF (Pseudomonas syringae pv. syringae B728a)
MSIPRMKSYFSLIAAVLMLGQVATAQAENLPDFTGLVEQASPAVVNISTRQKLPDRAVAN
QQMPDLEGLPPMLREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIISPDGYVLTNN
HVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIEGKDLPTAKLGNSNTLKVGEWVL
AIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMAGEVVGINS
QIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDLAESFGLDKPA
GALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSKAELEVIRDGK
RQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDLKGGVAIKEVT
GGPASLIGLQAGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVLRQGRATFITFKLS
E