Protein Info for Psyr_3887 in Pseudomonas syringae pv. syringae B728a

Annotation: Electron transport complex, RnfABCDGE type, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 10 to 142 (133 residues), 213.5 bits, see alignment E=9.6e-68 PF04060: FeS" amino acids 21 to 52 (32 residues), 44.3 bits, see alignment 3e-15 PF14697: Fer4_21" amino acids 84 to 138 (55 residues), 67.5 bits, see alignment E=2.3e-22 PF13237: Fer4_10" amino acids 86 to 132 (47 residues), 28.3 bits, see alignment 3.5e-10 PF00037: Fer4" amino acids 86 to 106 (21 residues), 26.3 bits, see alignment (E = 1.2e-09)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 100% identity to psb:Psyr_3887)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPK5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Psyr_3887 Electron transport complex, RnfABCDGE type, B subunit (Pseudomonas syringae pv. syringae B728a)
MTELIRLLPDVDLIRSIDALLPQTQCGKCGHPGCKPYAEGIAGGEAINKCPPGGDETIVQ
LAELLSVPVLTLDLQRGTAPAQVAFIREAECIGCTKCIQACPVDAILGAAKLMHTVIINE
CTGCDLCIAPCPVDCIEMHPLPLATVTPVVGGLAPTPELQEARQRKRSHARMRFEARNAR
LHREQQTRLAERLARSQRVESARDVLPRSAAALARNDKPAGPDEAVKKARIALAMSRAQL
NKSLKAFGHPPIAEQAARLVELQREYEAAEQALAALLPLPAQAHSEEKLRP