Protein Info for Psyr_3876 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 144 to 155 (12 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 122 (102 residues), 59.7 bits, see alignment E=1.7e-20 PF00528: BPD_transp_1" amino acids 44 to 228 (185 residues), 63.9 bits, see alignment E=8.6e-22

Best Hits

Swiss-Prot: 61% identical to HISM_SALTY: Histidine transport system permease protein HisM (hisM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 99% identity to psp:PSPPH_1386)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPL6 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Psyr_3876 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a)
MIELLQEYWKPFLYTDGVNVTGLAMTMWLLSASIAIGFCVSIPLSIARVSRNRWVRWPVQ
FYTYLFRGTPLYIQLLICYTGIYSLAAVREQPMLDAFFRDAMNCTILAFTLNTCAYTTEI
FAGAIRSMAHGEVEAAKAYGLTGWKLYAYVIMPSVLRRSLPYYSNEVILMLHSTTVAFTA
TVPDILKVARDANSATFMTFQSFGIAAVMYLTVTFILVGLFRLAERRWLAFLGPAH