Protein Info for Psyr_3863 in Pseudomonas syringae pv. syringae B728a

Annotation: SEC-C motif protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF17775: YchJ_M-like" amino acids 30 to 127 (98 residues), 101.3 bits, see alignment E=4.6e-33 PF02810: SEC-C" amino acids 136 to 152 (17 residues), 34.9 bits, see alignment (E = 1.1e-12)

Best Hits

Swiss-Prot: 100% identical to Y3863_PSEU2: UPF0225 protein Psyr_3863 (Psyr_3863) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 100% identity to psb:Psyr_3863)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPM9 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Psyr_3863 SEC-C motif protein (Pseudomonas syringae pv. syringae B728a)
MSSAICPCGSGDLLLACCGRYHAGQPAPGAEKLMRSRYSAYVLGLTDYLVQTTLPVQQGG
LDREAIAQWSAQSTWLGLEVESSEVFGGKPEHAFVTFTARWHDGNGEHSHRERSSFVQNQ
GRWYFIDSTVPLKAGRNDACPCGSEQKFKKCCSAYVE