Protein Info for Psyr_3842 in Pseudomonas syringae pv. syringae B728a

Annotation: SNF2-related:Helicase, C-terminal:Type III restriction enzyme, res subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 948 PF18339: Tudor_1_RapA" amino acids 5 to 55 (51 residues), 82.1 bits, see alignment 7.8e-27 PF18337: Tudor_RapA" amino acids 57 to 118 (62 residues), 75.4 bits, see alignment 1.1e-24 PF04851: ResIII" amino acids 156 to 315 (160 residues), 40.8 bits, see alignment E=8.1e-14 PF00176: SNF2-rel_dom" amino acids 169 to 345 (177 residues), 52.5 bits, see alignment E=1.4e-17 PF00270: DEAD" amino acids 172 to 315 (144 residues), 26.5 bits, see alignment E=1.7e-09 PF00271: Helicase_C" amino acids 474 to 584 (111 residues), 54.4 bits, see alignment E=4.8e-18 PF12137: RapA_C" amino acids 588 to 946 (359 residues), 460 bits, see alignment E=2e-141

Best Hits

Swiss-Prot: 100% identical to RAPA_PSEU2: RNA polymerase-associated protein RapA (rapA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 100% identity to psb:Psyr_3842)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPQ0 at UniProt or InterPro

Protein Sequence (948 amino acids)

>Psyr_3842 SNF2-related:Helicase, C-terminal:Type III restriction enzyme, res subunit (Pseudomonas syringae pv. syringae B728a)
MAQQYQPGQRWISDSEAELGLGTVLAQDGRLLTVLYPATGETRQYALRNAPLTRVRFSPG
DVITHFENWKMTVREVDDVDGLLVYHGLNAQNELVTLPETQLSNFIQFRLATDRLFAGQI
DQLSWFSLRYNTLEHTSRQLQSSLWGLGGVRAQPIAHQLHIAREVADRIAPRVLLADEVG
LGKTIEAGLVIHRQLLSGRASRVLILVPENLQHQWLVEMRRRFNLQVALFDAERFMESDA
GNPFEDTQLALVALEWLVEDEKAQDALFAAGWDLMVVDEAHHLVWHEDKASREYSLVEQL
AEVIAGVLLLTATPEQLGQDSHFARLRLLDPNRFHDLKAFRAESENYRPVAQAVQELLDK
GKLSAAAQETIHGFLGAEGDSLLAAVNTGDEEAKSRLIRELLDRHGTGRVLFRNTRAAVQ
GFPERKLHQYPLPCPVEYLELPVGEHADLYPEVSFQSHSDVSEEERWWRFDPRVDWLIDT
LKMLKRVKVLVICAHAETAMDLEDALRVRSGIPATVFHEGMNILERDRAAAYFADEEFGA
QVLICSEIGSEGRNFQFSHHLVLFDLPSHPDLLEQRIGRLDRIGQKHTIELHVPFLETSP
QARLFQWYHEALNAFLNTCPTGNALQHQFGPRLLPLLESGDDDKWQTLINEARSERERLE
SELHTGRDRLLELNSGGAGEGEALVEAILDQDDQFSLPIYMETLFDAFGIDSEDHSENAL
ILKPSEKMLDASFPLGDDEGVTITYDRNQALSREDMQFITWEHPMVQGGMDLVLSGSMGN
TAVALIKNKALKPGTVLLELIYVSEVVAPRSLQLGRYLPPAALRCLLDPNGNDLASRVSF
NTLNDQLESVPRASANKFIQAQRDQLTPRINAGEEKIMPKHAERVAEAQRRLAADTEEEL
ARLTALQAVNPTVRDSELVALRTQREQGLAMLEKAALRLEAIRVLVAG