Protein Info for Psyr_3774 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF13188: PAS_8" amino acids 12 to 59 (48 residues), 21.3 bits, see alignment 5e-08 TIGR00229: PAS domain S-box protein" amino acids 13 to 106 (94 residues), 27.4 bits, see alignment E=1.6e-10 PF08448: PAS_4" amino acids 16 to 118 (103 residues), 29.2 bits, see alignment E=2.4e-10 PF13426: PAS_9" amino acids 19 to 102 (84 residues), 36 bits, see alignment E=1.8e-12 PF00512: HisKA" amino acids 172 to 231 (60 residues), 55.7 bits, see alignment E=1.1e-18 PF02518: HATPase_c" amino acids 280 to 389 (110 residues), 73.3 bits, see alignment E=5.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3774)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPW7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Psyr_3774 PAS (Pseudomonas syringae pv. syringae B728a)
MTVEQVSLPVTEDLYEHAPCGLLITLPNGTIERANLTFCRWLGLERDAVVGRRFQDLLSL
AGKAFLQTHWAPTLQSQGSIAEVKVELIHADGRPIPMMLNAVRREYPSGYLHEVAVFLAE
ERNKYERELLAARKIAEELLQQQMTVQSELTSARNRLRLAHAEAEIRAIFAEQMIGIVSH
DLRNPLAAIKMAAGLLERTPLESRQERILGHINHSTDRADRMIVDLLDFTHARVGSGITV
VPQPIDFHAVVARGVEELRQVFPGRVLTHRSEGQGACSADPDRLLQMLGNLVSNAINYGA
DDGEVLITSSFDTWMIKLSVHNLGEPIPMEKVDDLYEPVVRVVSDSDETRTVGLGLFIVR
EIVRAHLGDVTVRSSAEEGTTFTVAFPRPPVKSEV