Protein Info for Psyr_3744 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF214

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 245 to 268 (24 residues), see Phobius details amino acids 288 to 314 (27 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details amino acids 690 to 713 (24 residues), see Phobius details amino acids 744 to 764 (21 residues), see Phobius details amino acids 785 to 808 (24 residues), see Phobius details PF02687: FtsX" amino acids 247 to 371 (125 residues), 25.9 bits, see alignment E=8.9e-10 amino acids 698 to 813 (116 residues), 51.7 bits, see alignment E=8.8e-18 PF12704: MacB_PCD" amino acids 467 to 620 (154 residues), 28.8 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to psb:Psyr_3744)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPZ7 at UniProt or InterPro

Protein Sequence (826 amino acids)

>Psyr_3744 Protein of unknown function DUF214 (Pseudomonas syringae pv. syringae B728a)
MRVFYWTLRALLSHWRRHPVQFFSVLTGLWLATALLTGVQALNSQARESYQRASQLIGGE
PQTRITASSGGLFPQALFIELRREGWPVSPMLQGRIVLQGREDRRLQLMGIEPVTLPTGS
ALAGQTLNAEQVVDFLTPPGMTWIAPQTLQALGLEEGQQPLTETGVALPPLRAKPDMAPG
VLLTDIGFAQPLLGQSGQLSEMLLAKDFARQNPVLPAALNDLLVIKKSGEENNLERLTES
FHLNLNALGVLSFIVGLFIVHAAIGLALEQRRGLLRNLRACGVSARLLIAALGVELGALA
LLGGVFGVVSGYLLASLLLPDVAASLRGLYGAEVAGQLNLSLWWWLSGIGLSLLGALLAG
ANSLLRAARLPLLALADAQAWQQAHARWLQRQAWVAVLGAVVGVSALVFGTSLMLGFVMM
SALLLSAALALPVLLDAMLGGLLKRSRSVLGQWFVADCRQQLPALSLALMALLLAMAANI
GAGSMTSGFRQTFNSWLEQRLTAELYVSPQNPEQAGPLNTWLNQQPDVGAVLPNWQVPVQ
VQGWPADLFGVIDHSIYRQHWALLESVAGDPWNVLRDEDTVMLSEQLARRLQLGLQDTLS
IPVPNGKWTPRIVGIYADYGNPKGHLLVNEKHLLAHWPQSMPVRFNLRVDQAAIPSLVTR
LQARFKLDDNHIIDQSQLKGWSSQVFERTFAATAALNSLTLGVAGVALFISLLTQSQSRL
GQLAPLWALGVTRRQLMLLNLGQTWLLAVLTLVLALPLGLLLAWCLDAVINVRAFGWRLP
LQVFPLQLLQLMALAMLATLLASAWPLLKLYRSRPADLLRTFANEP