Protein Info for Psyr_3743 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00005: ABC_tran" amino acids 21 to 166 (146 residues), 114.5 bits, see alignment E=2.9e-37

Best Hits

Swiss-Prot: 44% identical to YBBA_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli (strain K12)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to psb:Psyr_3743)

MetaCyc: 38% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPZ8 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_3743 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MLQVRNVFKRYTTAQGPLDVLRGVDLHLAQGESLALMGESGSGKSTLLHLVAGLDQVDDG
SIEVAGQRLDLMNESQLANWRRTEIGLVFQQFNLIGSLKIADNLAFQARLAGRVDADWQA
HLIERLGLGALLDRYPEQLSGGQQQRVAIGRALASRPGLLLADEPTGNLDEATSDEVLQL
LLDILTDSPTSLLMVTHSPRVAQRLSRKVVLHLGRLADEGER