Protein Info for Psyr_3742 in Pseudomonas syringae pv. syringae B728a

Annotation: FAD dependent oxidoreductase:Protein of unknown function DUF752

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 PF05430: Methyltransf_30" amino acids 113 to 233 (121 residues), 134.8 bits, see alignment E=3.1e-43 PF01494: FAD_binding_3" amino acids 262 to 298 (37 residues), 23.8 bits, see alignment 5e-09 TIGR03197: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain" amino acids 263 to 657 (395 residues), 465.1 bits, see alignment E=1.1e-143 PF01266: DAO" amino acids 263 to 628 (366 residues), 181.6 bits, see alignment E=6.5e-57 PF13450: NAD_binding_8" amino acids 265 to 302 (38 residues), 27.4 bits, see alignment 6.7e-10

Best Hits

Swiss-Prot: 100% identical to MNMC_PSEU2: tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (mnmC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3742)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPZ9 at UniProt or InterPro

Protein Sequence (665 amino acids)

>Psyr_3742 FAD dependent oxidoreductase:Protein of unknown function DUF752 (Pseudomonas syringae pv. syringae B728a)
MTITRHAQIDWDEHGNPRSRDFSDVYFSTESGLEETRHVFLVQNDLRRRFTELQDGGRLI
IGETGFGTGLNFLCAWQLFDECAPANARLQFVSVEKYPLSHADLQRALALWPELSPFAGQ
LLDQYVAVHEGFQRLVFAGGRVTLTLLIGDALQMLPQLDGQMDAWFLDGFAPAKNPEMWT
PELFAELARLSTSSTTIGTFTSTGWVRRSLNAAGFKMKRVPGIGHKWEVLRGTFIAWPED
VAHPPAAKPWLARPAPIGGERKALVIGAGLAGCATAQSLAQRGWQVSLLERHAAPAQEAS
GNPQGVLYLKLSAHGTALSQLILSGFGHTRRLLERLQRGVDWDACGVLQLTFDDKEALRQ
KQLADAFPESLLHLLDKPAAEAQSGVALNSGGLFYPEGGWVHPPALCHAQAAHANIRLIA
HQQALELRRVDDQWQVWSEEQLVDSAPVVVLAGAADIQQFSQSADLPLKRIRGQITRLPQ
TQASTALRSVVCAEGYVAPARLGEHTLGASFDFNSTDLTPNLADHLDNLGLLREISEDLT
SRLDTADLSPEQLQGRAAFRCTSPDYLPIVGPLADREAFMQAYAALGKDARQVPDITCPW
LDGLYVNSGHGSRGLITAPLCGELIAAWLDNEPLPLPRSVAEACHPNRFALRGLIRGKGK
QTVGH