Protein Info for Psyr_3735 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 192 (17 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 17 to 111 (95 residues), 46.3 bits, see alignment E=2.3e-16 PF00989: PAS" amino acids 21 to 108 (88 residues), 42.5 bits, see alignment E=1.2e-14 PF13426: PAS_9" amino acids 24 to 110 (87 residues), 39.1 bits, see alignment E=1.5e-13 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 63.8 bits, see alignment E=2.9e-21 PF00015: MCPsignal" amino acids 332 to 487 (156 residues), 144.8 bits, see alignment E=4.8e-46

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 100% identity to psb:Psyr_3735)

Predicted SEED Role

"aerotaxis receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ06 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Psyr_3735 PAS (Pseudomonas syringae pv. syringae B728a)
MRVNMPITQTERTFPASERLISTTDLNSHITYCNDAFVTLSGFTREELVGQPHNLVRHPD
MPASVFAHMWETIKQGKPWMGVVKNRSKQGDYYWVSAYVTAVYENGRIVGYESVRSLPTR
DQVRRAEALYARLRAGKAAVSASSSAAYHLIRQLPMILCALALAVGVYLLDDLPSIIMIP
IVMVVLGVFLEVRQRSSIRKTLEEHPKAFTSALIALTYSDSRGPQAQLDLAMLSEEARLQ
TALTRLADTGESVRQHAGRSAQLSLRQAESLDQQRSEADQSATAINQMAATIQEVTHNVQ
NTAHAAEEADKLAQQGRGLADESLLAIRHMATSVTDIGNAVGELADATQSIGSVVDVITS
IAQQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQSSTEQIQQIITSLRDGADR
AVKTASKGEQISQESVASVEAVQKALDGISQSVTRITGMSQQMASASEEQSHVAETISQQ
ITRIAQLCDESASQAQQGSQISSELEEMAQYLHSLAERFSR